Ihr Qtral Shop

Maria Galland Ultim'Boost 004 Éclat 15 ml
Angebot
59,95 € *
ggf. zzgl. Versand

Produktbeschreibung Die Wirkstoffe des Energy Booster-Komplexes Maria Galland Ultim'Boost 004 Éclat energetisiert die Haut tiefenwirksam. Leichte, flüssige Texturen, schnelle Absorption in nur weniger Sekunden. Die Haut ist sofort mit neuer Energie versorgt und strahlt. Professionelle Verpackung: Die Pipette gibt exakt die richtige Produktmenge ab. Sinnliche Pflege: Sofort von der Haut absorbierte Texturen mit dezenter Parfümierung. Sofort Wirkung: Serum und Creme können unmittelbar danach der Maria Galland Ultim'Boost 004 Éclat aufgetragen werden. 24-karätiges Gold Energy Booster Zuckerhirse-Extrakt Nutzen Die Haut ist sofort mit neuer Energie versorgt und strahlt. Neuartige, maßgeschneiderte „Boosting-Technologie“: diese Technologie verstärkt die Wirkung der nachfolgend aufgetragenen Produkte und sorgt für eine optimale Wirkstoffaufnahme in die Haut. Anwendung Morgens und abends 5 tropfen des Maria Galland Ultim'Boost 004 Éclat über eine dauer von 28 tagen vor der anwendung von serum und creme auf gesicht, hals und dekolleté auftragen. Haupt-Wirkstoffe 73% LIFTING BOOSTER INDEX* Diamant-Komplex für eine straffere und dichtere Haut. Schweizer Eiswein-Extrakt mit Anti-Aging-Wirkung für eine festere Haut, reduzierte Falten und feine Linien. *DERMATOLOGISCH BESTÄTIGTE TESTERGEBNISSE. EINE STRAFFERE, JUGENDLICHE HAUT, DIE SICH WIE GELIFTET ANFÜHLT. Anwenderbefragung mit 50 Probanden (im Alter von 35–64) nach der Anwendung von 005 ULTIM’BOOST / TENSEUR unter dermatologischen Bedingungen über einen Zeitraum von 4 Wochen; Mittelwert (in %) aus den individuellen Resultaten im Hinblick auf eine straffere, jugendliche Haut, die sich wie geliftet anfühlt.

Anbieter: SK Kosmetik
Stand: 20.01.2020
Zum Angebot
for-you-darm-schlank-index-for + you-darmflora-...
Beliebt
129,00 € *
ggf. zzgl. Versand

for you darm-schlank-indexSchlank mit Darm – Finde heraus, wie der for you darm-schlank-index Dich dabei unterstützen kann, das Verhältnis von Bacteroides und Firmicutes Bakterien in Deinem Darm zu optimieren. Die Darmflora – Experten sprechen vom „Mikrobiom“ – übergewichtiger und schlanker Menschen unterscheidet sich in vielen Fällen deutlich. Häufig zeigt sich bei Personen, die sich selber als „gute Futterverwerter“ bezeichnen oder mit überflüssigen Pfunden kämpfen, dass das Verhältnis der beiden dominierenden Bakterienstämme Bacteroides und Firmicutes in Schieflage geraten ist. Mit dem for you Darmtest misst Du Dein persönliches Verhältnis zwischen beiden Bakterienstämmen.Schlank mit Darm – So funktioniert‘sDer Mikrobenmix im Darm ist laut zahlreichen Studien dafür verantwortlich, wie gut oder schlecht wir unser Essen ausnutzen und wie viele Kalorien aus der Nahrung gezogen werden. Wichtig ist das Verhältnis der Firmicuten-Stämme zu den Bacteroides. Firmicutes-Bakterien können aus unverdauten Nahrungsbestandteile Kohlenhydrate und Fettsäuren gewinnen und diese als zusätzliche Energie zur Verfügung stellen. Firmicuten sind im Prinzip „Moppelbakterien“. Je mehr Firmicuten und je weniger Bacteroides sich im Darm befinden, desto größer ist das Risiko für Gewichtsprobleme. Nimmt die Zahl der Firmicuten, der „Moppelbakterien“ nur um 20 % zu, dann werden Tag für Tag 10 % mehr Kalorien in den Körper geschleust. Das hört sich zunächst nicht viel an, summiert sich aber im Laufe eines Jahres. Gleichzeitig geht mit steigenden Pfunden die bakterielle Vielfalt im Verdauungstrakt verloren.Anhand einer Darmfloraanalyse ließ sich in Studien vorhersagen, ob Kleinkinder zur Einschulung übergewichtig sein werden oder wie schwer es Schwangeren fallen wird, nach der Entbindung wieder die Pfunde zu verlieren.Antibiotika führen regelmäßig zu einer Störung der Darmflora. Je länger die Therapie dauert und je wirksamer das Medikament ist, desto stärker wurde das Mikrobiom verändert. Inzwischen gilt eine Antibiotikatherapie als ein Risikofaktor für Übergewicht.Schlank mit Darm – Durch Firmicuten und BacteroidesEine gesunde, vielfältige Darmflora mit einem günstigen Verhältnis zwischen Firmicuten und Bacteroides scheint laut aktuellen Studien hingegen der Garant für eine gute Figur zu sein. Ein gesundes Mikrobiom resorbiert nicht nur weniger Kalorien, es bildet zudem Substanzen, die Heißhunger dämpfen und Appetit zügeln.for you darmgesundheits-status Juniorfor you Darmtests eignen sich auch für Kinder ab 1 Jahr. Anhand des Geburtsdatums Deines Kindes wird das Ergebnis dann in altersgerechten Referenzwerten angezeigt.for you darm-schlank-index – Das messen wir für Dich:Verhältnis von Bacteroides und Firmicutes BakterienFinde mit dem for you darm-schlank-index heraus, wie das Bakterienverhältnis in Deinem Darm ist und wie leicht es Dir fällt, dank Deiner Darmbakterien schlank zu bleiben. Wissenschaftlicher Beirat Gemeinsam entwickelt mit Frau Prof. Dr. Axt-Gadermann. Ärztin und Professorin für Gesundheitsförderung. Bestsellerautorin der Bücherreihe „Schlank mit Darm". Darmtests sind keine Kassenleistung Nimm Deine Gesundheit in die eigene Hand! Analysen Deines Darms werden von den gesetzlichen Krankenkassen nicht übernommen und müssen daher auch beim Hausarzt selbst bezahlt werden. Selbst private Krankenkassen übernehmen die Kosten nur in speziellen Fällen. Daher gilt: Wir nehmen unsere Gesundheit in die eigene Hand! for you darmflora komplexBedeutung der Darmflora für unseren OrganismusLange Zeit wurde die Bedeutung einer gesunden Darmflora unterschätzt. Inzwischen steht fest: Darmbakterien nehmen Einfluss auf unsere körperliche und geistige Leistungsfähigkeit, sie schützen uns vor chronischen Erkrankungen und helfen uns, Stress besser zu verkraften.Eine ausgewogene Darmflora, der moderne Begriff dafür ist „Mikrobiom“, enthält eine vielfältige und abwechslungsreiche Mischung unterschiedlicher Mikroorganismen.Doch diese „blühenden Landschaften“ werden in unserem Verdauungstrakt immer seltener. Antibiotika und andere Medikamente, eine einseitige Ernährung, Lebensmittelzusätze und Bewegungsmangel lassen unsere Darmflora verarmen und eintönig werden.Um die Darmflora zu regenerieren, sind Synbiotika ideal. Diese enthalten nicht nur gesunde probiotische Bakterien, sondern auch wertvolle präbiotische Ballaststoffe. Diese präbiotischen Ballaststoffe könnte man als „Bakterienfutter“ bezeichnen, denn sie fördern Wachstum und Entwicklung der Darmflora.for you darmflora komplexUnser darmflora komplex enthält gleich zwei Arten von präbiotischen Ballaststoffen sowie 11 wirkungsvolle Bakterienstämme, die insgesamt für eine größere Bakterienvielfalt im Darm sorgen.Der präbiotische Ballaststoff resistentes Dextrin aus Mais (resistente Stärke) regt die Bildung entzündungshemmender Fettsäuren (z.B. Butyrat) im Darm an und fördert die Entwicklung von Bakterien, die speziell für die Darmbarriere und die Darmschleimhaut unerlässlich sind.Akazienfasern fördern hingegen wichtige Säuerungsbakterien wie Bifidokeime, die verhindern, dass sich unerwünschte Mikroorganismen im Darm breit machen können.Die Gesamtkeimzahl pro Tagesdosis (5 g) beträgt 22 Milliarden Bakterien, die aus 11 verschiedenen Bakterienstämmen zusammensetzen. In Studien konnte für diese Bakterienstämme nachgewiesen werden, dass sie günstige Effekte auf die psychische Verfassung haben und Stress und Anspannung abbauen können. Für andere Mikroorganismen in for you darmflora komplex wurde nachgewiesen, dass sie Leistungsfähigkeit, Regenerationsfähigkeit sowie Infektanfälligkeit günstig beeinflussen und in der Lage sind, Allergiesymptome zu lindern, die Gewichtsreduktion zu unterstützen und Reizdarmbeschwerden zu bessern. Die Zusammensetzung deckt somit ein weites Anwendungsfeld ab.Laktosefrei, glutenfrei, frei von Soja.Ohne Zusatzstoffe wie Aromen, Farbstoffe und SüßungsmittelResistentes Dextrin aus Mais und Akazienfaser sind gut verträglichSehr gute Löslichkeit im Glas und ShakerAbgefüllt in Deutschland nach ISO 9001 & dem IFS Food StandardDas können die enthaltenen Bakterienstämme:Bei Stress und Anspannung können die Milchsäurebakterien Lactobacillus plantarum, Lactobacillus rhamnosum, Lactobacillus helveticus sowie die Bifidobakterien Bifidobacterium longum und Bifidobacterium bifidum nicht nur die Stimmung verbessern, beruhigend wirken und Ängste lösen. Sogar die Stresshormonspiegel (Cortisolspiegel) ließen sich in Studien bereits nach 14 Tagen messbar senken.1Die beiden Bakterienstämme Steptococcus thermophilus und Bifidobacterium breve können bei Sportlern die Leistungsfähigkeit verbessern und die Regenerationszeit verkürzen.2Bifidobacterium lactis und Lactobacillus helveticus stimulieren das Immunsystem und verringern bei infektanfälligen Personen und leistungsorientierten Sportlern oder Stressgeplagten die Häufigkeit von Infekten.3Die Symptome bei Heuschnupfen und Allergien sprechen gut auf die Einnahme von Lactobacillus gasseri und Bifidobacterium bifidum an. Wichtig ist es, die Einnahme mindestens 8 Wochen vor Beginn der Allergiesaison zu starten.4Lactobacillus gasseri und Lactobacillus plantarum unterstützen eine Gewichtsreduktion wirkungsvoll.5Bifidobacterium infantis ist ein bewährter Keim zur Behandlung des Reizdarmsyndroms.6Quellen & Studien zum Weiterlesen1. Stress und Anspannung:1.1. Ingestion of Lactobacillus strain regulates emotional behavior and central GABA receptor expression in a mouse via the vagus nerve. Proc Natl Acad Sci U S A. 2011 Sep 20;108(38):16050-5, unter: https://www.ncbi.nlm.nih.gov/pubmed/218761501.2. Oral Administration of Lactobacillus plantarum 299v Reduces Cortisol Levels in Human Saliva during Examination Induced Stress: A Randomized, Double-Blind Controlled Trial. Int J Microbiol. 2016;2016:8469018, unter: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5217173/1.3. Beneficial psychological effects of a probiotic formulation (Lactobacillus helveticus R0052 and Bifidobacterium longum R0175) in healthy human volunteers. Gut Microbes. 2011 Jul-Aug;2(4):256-61, unter: https://www.tandfonline.com/doi/abs/10.4161/gmic.2.4.161081.4. Assessment of psychotropic-like properties of a probiotic formulation (Lactobacillus helveticus R0052 and Bifidobacterium longum R0175) in rats and human subjects. Br J Nutr. 2011 Mar;105(5):755-64, unter: https://www.ncbi.nlm.nih.gov/pubmed/209740152. Leistungsfähigkeit und Regeneration: Probiotic Streptococcus thermophilus FP4 and Bifidobacterium breve BR03 Supplementation Attenuates Performance and Range-of-Motion Decrements Following Muscle Damaging Exercise. Nutrients. 2016 Oct 14;8(10): 642, unter: https://www.mdpi.com/2072-6643/8/10/6423. Immunsystem und Häufigkeit von Infekten:3.1. Lactobacillus helveticus Lafti L10 supplementation reduces respiratory infection duration in a cohort of elite athletes: a randomized, double-blind, placebo-controlled trial. Appl Physiol Nutr Metab. 2016 Jul;41(7):782-9, unter: https://doi.org/10.1139/apnm-2015-05413.2. Probiotic supplementation for respiratory and gastrointestinal illness symptoms in healthy physically active individuals. Clin Nutr. 2014 Aug;33(4):581-7, unter: https://linkinghub.elsevier.com/retrieve/pii/S02615614130026164. Heuschnupfen und Allergien: Probiotics (Lactobacillus gasseri KS-13, Bifidobacterium bifidum G9-1, and Bifidobacterium longum MM-2) improve rhinoconjunctivitis-specific quality of life in individuals with seasonal allergies: a double-blind, placebo-controlled, randomized trial. Am J Clin Nutr. 2017 Mar;105(3):758-767, unter: https://academic.oup.com/ajcn/article/105/3/758/45697005. Gewichtsreduktion: Effect of Lactobacillus on body weight and body fat in overweight subjects: a systematic review of randomized controlled clinical trials. Int J Obes (Lond). 2017 Nov;41(11):1607-1614, unter: https://www.nature.com/articles/ijo20171616. Reizdarmsyndrom: Efficacy of Bifidobacterium infantis 35624 in patients with irritable bowel syndrome: a meta-analysis. Curr Med Res Opin. 2017 Jul;33(7):1191-1197, unter: https://www.ncbi.nlm.nih.gov/pubmed/28166427Unsere for you Produkte sind nach dem IFS Food Standard zertifiziert. Der anerkannte IFS Food Standard dient der Auditierung von Lebensmittelherstellern hinsichtlich Lebensmittelsicherheit und Qualität der Verfahren und Produkte.

Anbieter: for you eHealth
Stand: 20.01.2020
Zum Angebot
forever young vitamineral32 Maracuja
Unser Tipp
47,00 € *
ggf. zzgl. Versand

forever young vitamineral32 ist ein hochwertiges und ausgewogenes Multi-Vitalstoffprodukt zur gezielten täglichen Nahrungsergänzung mit 32 Nährstoffen wie Vitaminen, Provitaminen, Mineralstoffen und Spurenelementen, sekundären Pflanzenstoffen, weiteren wichtigen Substanzen und traumhaften Waldbeeren- oder Maracuja-Geschmack. vitamineral32 eignet sich nicht nur hervorragend für Sportler, sondern für alle Menschen, die in punkto Ernährung besondere Ansprüche stellen. Die EFSA ( Europäische Behörde für Lebensmittelsicherheit ) hat nach umfangreichen Untersuchungen u.a. folgende Wirkungen der in forever young vitamineral32 enthaltenen Nährstoffe eindeutig bestätigt.Die 13 Geheimnisse von forever young vitamineral321. Energie Die Vitamine B1, B2, B6, B12, Biotin, Pantothensäure, Niacin und Vitamin C sowie die Mineralstoffe Magnesium, Calcium, Eisen, Jod, Kupfer und Mangan tragen zu einem normalen Energiestoffwechsel bei.2. Vitalität Magnesium, Eisen, die Vitamine Niacin, Pantothensäure, B2, B6, B12Folsäure und Vitamin C tragen zu einer Verringerung von Müdigkeit und Ermüdung bei.3. Immunsystem Eisen, Zink, Kupfer, Selen, Vitamin A, B12, B6, Folsäure und Vitamin D tragen zu einer normalen Funktion des Immunsystems bei; Vitamin C vor allem auch während und nach sportlicher Belastung, wenn mindestens 200 mg Vitamin C zusätzlich zur normalen Ernährung genommen werden. Eine Portion forever young vitamineral32 sichert dies durch 300 mg Vitamin C pro Portion.4. Schutz vor oxidativem Stress Vitamin C, Vitamin E, B2, Kupfer, Selen und Zink tragen dazu bei, die Zellen vor oxydativem Stress zu schützen.5. Herz und Gefäße Vitamin B 1 trägt zu einer normalen Herzfunktion bei . Vitamin C trägt zu einer normalen Kollagenbildung für normale Blutgefäße bei.6. Blutbildung und Sauerstoffversorgung Eisen, Vitamin B12, B6 und Folsäure tragen zur normalen Bildung von roten Blutkörperchen bei. Eisen trägt zur Bildung von Hämoglobin und einem normalen Sauerstofftransport im Körper bei. Vitamin K trägt zu einer normalen Blutgerinnung bei.7. Muskulatur und Bindegewebe Calcium, Magnesium und Vitamin D tragen zu einer normalen Muskelfunktion bei. Kupfer und Mangan tragen zu einer Erhaltung von normalen Bindegewebe bei.8. Knochen und Zähne Vitamin K, Mangan und Zink tragen zur Erhaltung normaler Knochen bei. Calcium, Magnesium, Vitamin D zusätzlich auch zur Erhaltung normaler Zähne. Vitamin C trägt zu einer normalen Kollagenbildung für eine normale Funktion von Knorpel und Knochen sowie von Zähnen und Zahnfleisch bei.9. Nervensystem und mentale Leistungsfähigkeit Die Vitamine B1,B2, B6, B12, Biotin, Niacin, Vitamin C, Magnesium Jod und Kupfer tragen zur normalen Funktion des Nervensystems bei, die Vitamine B1, B6, B12, Biotin, Niacin, Folsäure, Vitamin C und Magnesium tragen zu einer normalen psychischen Funktion bei. Eisen, Zink und Jod tragen zu einer normalen kognitiven Funktion bei.10. Augen Vitamin A, B2 und Zink tragen zur Erhaltung normaler Sehkraft bei.11. Stoffwechsel Biotin und Chrom tragen zu einem normalen Stoffwechsel von Makronährstoffen bei. Cholin und Zink tragen zu einem normalen Fettstoffwechsel bei . Selen, Zink und B6 tragen zu einem normalen Eiweißstoffwechsel bei. Chrom trägt zu einem normalen Blutzuckerspiegel bei. Cholin und Folsäure tragen zu einem normalen Homocysteinstoffwechsel bei. Selen und Jod tragen zu einer normalen Schilddrüsenfunktion bei.12. Säure-Basen-Haushalt und Elektrolyte Zink trägt zu einem normalen Säure-Basen-Haushalt bei. Magnesium trägt zum Elektrolytgleichgewicht bei.13. Haut , Haare, Nägel Vitamin A, Biotin, Niacin, Vitamin B2, Jod und Zink tragen zu einer normalen Funktion der Haut bei. Biotin, Selen und Zink tragen zur Erhaltung normaler Haare bei. Kupfer trägt zur normalen Pigmentierung von Haut und Haaren bei. Zink und Selen tragen zur Erhaltung normaler Nägel bei.Unsere forever young Produkte sind zertifiziert! So garantieren wir Ihnen eine gleichbleibend hohe Qualität: TÜV Nord Zertifikat für das Managementsystem nach DIN EN ISO 9001 : 2008.GMO Zertifikat - Die Produkte wurden gemäß der Verordnung (EG) Nr. 1829/203 und der Verordnung (EG) 1830/2003 nicht mittels genetisch modifizierter Organismen hergestellt und enthalten keine Inhaltsstoffe, die aus genetisch veränderten Organismen hergestellt wurden bzw. die selbst genetisch modifiziert sind.Bescheinigung durch die Kontrollstelle ABCERT AG gemäß Artikel 29 Absatz 1 der Verordnung (EG) Nr. 834/2007 und der Verordnung (EG) Nr. 889/2008. Pflanzliche Erzeugnisse, tierische Erzeugnisse, verarbeitete Erzeugnisse.

Anbieter: for you eHealth
Stand: 20.01.2020
Zum Angebot
Goldinvest Münzuhr - Erneuerbare Energie - Limi...
699,00 € *
zzgl. 2,95 € Versand

Goldinvest Collection - Armbanduhr - Erneuerbare Energie Modell: Erneuerbare Energie Gehäusematerial: Edelstahl Gehäusedurchmesser ca.: 39 mm, Höhe 9,50 mm Zifferblattfarbe: Münzvorderseite, siehe Bild Uhrenglas: Saphirglas Bodenglas: Saphirglas, Münzhinterseite, siehe Bild Armbandmaterial: Leder, Krokodesign Armbandfarbe: schwarz Armbandschließe: Dornschließe Uhrwerk: schweizer Quarzwerk RONDA Kaliber 763 Funktionen: Standard Wasserdicht / Water resistant: 30 Meter / 3 ATM Eine neue Produktlinie sind die Münzuhren aus der GOLDINVEST COLLECTION Bei diesen Uhren werden echte Münzen in der Mitte geteilt und zum Ziffernblatt und zur Rückseite der Uhr verarbeitet! Originalmünze: 25 EURO Bimetall, Münze Österreich AG, Ausgabetag 09. März 2010 Ring: Silber 900/1000, Feingewicht 9,00g, Kern: Niob 6,50g Die Präzision der auf 100 Stück limitierenDreizeiger Uhr wird durch ein Schweizer Quarz Uhrwerk garantiert, 30 Meter Wasserdichtheit und ein Volllederband ergänzen unsere Qualitätsansprüche. Jedes Modell ist an der Gehäuse Rückseite nummeriert und wird auf Ihren Wunsch von uns registriert. Die Uhr ist auf nur 100 Stück limitiert , wird in einem edlen Holzetui geliefert

Anbieter: mirapodo
Stand: 20.01.2020
Zum Angebot
Pure Elements Pflege Chi Energie Duschgel 200 ml
Bestseller
18,95 € *
zzgl. 3,50 € Versand

Das Pure Elements Chi Duschgel enthält wertvolle Pflegestoffe. Ihre Haut wird intensiv, und dennoch sanft, durch Waschsubstanzen auf Basis natürlicher, nachwachsender Rohstoffe gereinigt. Dieses wunderbare Duschgel schenkt Ihnen ein prickelndes Duscherlebnis voller Frische. Der enthaltene, positiv geladene Bergkristall sowie die ätherischen Öle spenden Ihrer Haut zusätzliche Energie. Frei von Konservierungsstoffen. Für Veganer geeignet.

Anbieter: parfumdreams
Stand: 20.01.2020
Zum Angebot
Nuxe Herrenpflege Nuxe Men Fluide Anti-Âge Rech...
Empfehlung
29,95 € *
ggf. zzgl. Versand

Mit dem Nuxellence Fluide Nuxe Men hat der Hersteller von Kosmetik-Produkten Nuxe ein Mittel im Bereich Pflege Anti-Aging Pflege speziell für Herren kreiert, das seine einzigartige Wirkung auf die Haut den hochwertigen Wirkstoffen aus Baumextrakten verdankt. Diese Pflege der neuesten Generation wirkt völlig ohne Parabene und fettet nicht. Die Anwendung der speziellen Inhaltsstoffe im Nuxellence Fluide Nuxe Men macht die Gesichtshaut straffer, belebt sie neu und verleiht ihr Tag für Tag eine frische Jugendlichkeit. Nuxe ist es mit diesem Kosmetik-Fluide gelungen, eine Pflege Anti-Aging Pflege anzubieten, die bei Hauttypen jeden Alters garantiert Falten glättet und für einen frischen Teint sorgt. Von der Forschung zur perfekten Pflege Anti-Aging PflegeIm Rahmen ausführlicher Kosmetik-Forschung bezüglich der Jugendlichkeit der Zellen ist Nuxe dabei auf die Rolle der doppelsträngigen DNA in der Matrix als Garant für ein optimales Energieniveau gestoßen. Sie sorgt täglich für die einwandfreie Funktion der Haut, die dann allerdings mit zunehmendem Alter durch Entladen der Zellen verändert und geschwächt wird. Dabei hat das Labor herausgefunden, dass ein spezielles Pflanzentrio aus Passionsblume, Acker-Krummhals und Mohnblume die betroffene DNA reparieren kann. Dieses Trio dient jetzt im Nuxellence Fluide Nuxe Men als echte Anti-Aging-Komplettpflege für die Männerhaut.

Anbieter: parfumdreams
Stand: 20.01.2020
Zum Angebot
Energie
49,99 € *
ggf. zzgl. Versand

In dem vorliegenden Band wird naturwissenschaftlich-physikalische Hintergrundinformation zum Thema Energie bereitgestellt, um dem Leser objektive Bewertungskriterien für die global hochaktuelle Diskussion der Zukunft unserer Energieversorgung an die Hand zu geben. Insbesondere ist es ein zentrales Anliegen, dem Leser eine Bilanzierung aller Quellen hinsichtlich der Einflussnahme ihrer Gewinnung und Verwendung auf die Umwelt zu erstellen und das jeweilige Risiko zueinander in Relation zu setzen. Nach Festlegung des Begriffes Energie und ihrer Erscheinungsformen werden globale Randbedingungen des Umgangs mit Energie aufgezeigt. Diese Randbedingungen werden sodann für Deutschland als typischem Industrieland enger eingegrenzt. Die Palette infrage kommender Quellen, fossile, erneuerbare und nukleare, wird sodann im Detail vorgestellt. Ergiebigkeit der Ressourcen sowie sonstige Möglichkeiten und Grenzen des Einsatzes werden diskutiert, alle Energiequellen werden sodann nach Definition eines energetischen Erntefaktors miteinander verglichen. Die Speicher- und Transportmöglichkeiten und - hiermit eng verbunden - die Handlungsspielräume rationellen Umgangs mit den diversen Formen der Energie bilden einen weiteren Schwerpunkt. Der an naturwissenschaftlicher Hintergrundinformation interessierte Leser findet in einem gesonderten Kapitel eine detaillierte Präsentierung ausgewählter Techniken.

Anbieter: Dodax
Stand: 20.01.2020
Zum Angebot
HEDI Energie-Hängeverteiler 250
59,70 € *
ggf. zzgl. Versand

Eigenschaften:Kompakter Energie-Hängeverteiler mit robustem, hartgummiverstärktem Gehäuse zur platzsparenden und ordnungssichernden Spannungs- bzw. DruckluftverteilungAusgangssteckdosen mit selbstschließenden DeckelnEinfache Kabeleinführung mit Zugentlastung.Aufhängeöse und massiver Werkzeughaken.Spritzwassergeschützt IPX4.

Anbieter: Contorion
Stand: 20.01.2020
Zum Angebot
Energie-Punkt-Pyramide -- Scheitel
173,50 € *
ggf. zzgl. Versand

Energie-Punkt-Pyramide (Kronen)-Chakra EnergiepunktEintrittspunkt für die Aufnahme kosmischer Energie, Bewusstseinszentrum der Spiritualität und Religösität.Anwendung/Position: Pyramide oberhalb des Kopfes auf den Boden hinstellen.

Anbieter: Rakuten
Stand: 20.01.2020
Zum Angebot
for you natural basenpulver 2er-Set
Aktuell
33,00 € *
zzgl. 3,90 € Versand

So wichtig ist ein ausgewogener Säure-Basen-HaushaltEin ausgewogener Säure-Basen-Haushalt ist neben dem Vitamin- und Mineralstoffhaushalt eine der wichtigsten Säulen des Stoffwechsels. Durch unsere moderne Lebensweise, körperlichen und geistigen Stress oder den Konsum zu vieler säurebildender Lebensmittel wie Zucker, Kohlehydrate und auch tierischem Eiweiß, neigt unser Körper zur Bildung von zu vielen Säuren. Er übersäuert.An sich kann unser Körper die Säuren selbstständig wieder abbauen. Sie werden mit Hilfe von Kalium, Calcium, Zink und Magnesium neutralisiert. Werden aber zu viele Säuren gebildet, kommt er an seine Grenzen. Um das Säure-Basen-Gleichgewicht zu halten, beginnt der Körper damit Mineralstoffe aus unseren Knochen, Zähnen, Haaren, Blutgefäßen und Organen zur Neutralisierung zu verwenden.Das spüren wir durch:Chronische MüdigkeitFehlende EnergieKopfschmerzenVerdauungsproblemeHaarausfallEine chronische Übersäuerung kann zu:Einem schwachen ImmunsystemsHerz-Kreislauf-ErkrankungenBeeinträchtigung von Verdauung und DarmfloraAllergienKariesAbbau von MuskelmasseNerven-, Muskel- und Gelenkschmerzenund einigem mehr führen. Basenpulver gegen ÜbersäuerungBasenpulver hilft gegen Übersäuerung, liefert neue Energie und fördert das Wohlbefinden. Du bist wieder leistungsfähiger und bewahrst Deinen Körper vor chronischen Krankheiten. Säuren und Schlacken werden in kurzer Zeit neutralisiert und ausgeschieden, der Körper wird entlastet.Unser for you natural basenpulver enthält die Mineralstoffe Kalium, Calcium, Magnesium, Eisen und Zink und dazu besonders wenig Natrium. Die Aufnahme von Kalium und die Reduktion von Natrium sind für die Aufrechterhaltung eines normalen Blutdrucks sehr wichtig. Viele Menschen sind mit Kalium unterversorgt und haben gleichzeitig eine Überversorgung mit Natrium. In der Zusammensetzung unseres Basenpulvers haben wir besonders auf ein ideales Mineralstoff-Verhältnis geachtet und dazu noch die Vitamine C und D ergänzt.Magnesium und Eisen tragen zu einer Verringerung von Müdigkeit und Ermüdung bei. Bedeutsam für eine intrazelluläre Entsäuerung.Kalium reguliert das Säure-Basen Gleichgewicht, entsäuert Zellen und trägt zu einem normalen Blutdruck bei.Calcium, Magnesium, Eisen und Kupfer tragen zu einem normalen Energiestoffwechsel bei.Zink trägt zu einem normalen Säure-Basen-Stoffwechsel und zur Erhaltung normaler Nägel, Knochen und Zähne bei.Vitamin C und D, Zink, Kupfer, Eisen und Selen tragen zu einer normalen Funktion des Immunsystems bei.Calcium, Magnesium, Zink und Vitamin D tragen zur Erhaltung normaler Knochen bei. Wesentlich bei einer Übersäuerung, um die Calciumentnahme aus den Knochen zu verhindern.Vitamin C unterstützt die Infektionsabwehr, wirkt als Radikalfänger und trägt zu einem normalen pH-Wert bei.Selen und Kupfer tragen dazu bei, die Zellen vor oxidativem Stress zu schützen.Natürliches BasenpulverUnser Basenpulver ist frei von Süßstoffen, künstlichen Aromen oder Geschmacksverstärkern. Es ist dadurch sehr gut verträglich, besonders auch für Menschen mit Darmproblemen. Ein Basenpulver, das sich auf das Wesentliche beschränkt - hochwertige Inhaltsstoffe - ohne Zusätze und Füllstoffe!

Anbieter: for you eHealth
Stand: 20.01.2020
Zum Angebot
Multipure SENSEH® Energie Scheibe, 1 Stück
Beliebt
99,15 € *
zzgl. 4,90 € Versand

Multipure SENSEH® Energie Scheibe Kleine Energie-Scheibe Material (Keramik)Trinkwasser-Energetisierung passend für alle Multipure Trinkwasserfilter Die SENSEH® Energie Keramik besteht aus energiereichem Mineralgestein, welches zu einer Keramikscheibe geformt wurde und in die Filtergehäuse eingelegt wird. Die Energiescheibe kann in allen Gehäusen verwendet werden. Das Multipure gefilterte Wasser wird durch die SENSEH® Energie-Keramik noch weiter veredelt und erhält nicht nur die Reinheit, sondern auch die Lebendigkeit und den Geschmack wie Quellwasser (Herstelleraussagen). ----------------------------------- Aus juristischen Gründen werden hier keine eigenen Aussagen zum Thema Wasserbelebung, Wasservitalisierung getroffen, sondern die Aussagen der Hersteller wiedergegeben. Der interessierte Kunde sollte sich vor dem Kauf über das wissenschaftlich kontrovers diskutierte Thema eine Meinung gebildet haben. Buchempfehlungen Eckhard Weber, Wasser vitalisieren. Trinkwasser aktivieren, energetisieren, beleben (ISBN-10: 3778791680) oder Ulrich Holst, Die Geheimnisse der Wasserbelebung (ISBN-10: 3928554522)

Anbieter: wasserstelle
Stand: 20.01.2020
Zum Angebot
Energie und Energieumwandlung, 1 DVD
31,29 € *
ggf. zzgl. Versand

Der Begriff 'Energie' umfasst verschiedene Arten von Energie. Chemische Energie zum Beispiel ist die Energie, die als chemische Verbindung in einem Energieträger gespeichert ist. Sie kann durch eine chemische Reaktion freigesetzt werden, etwa durch eine Verbrennung. Auch der Heizwert und der Brennwert sind chemische Energien. Häufig ist die Rede vom Energieverbrauch oder der Erzeugung von Energie. Beides ist irreführend, da nach dem Energieerhaltungssatz Energie nicht verbraucht oder hergestellt, sondern nur in eine andere Form umgewandelt werden kann. Elektromotoren verwandeln elektrische in mechanische Energie, während Generatoren den Prozess umkehren. Nur thermische Energie kann nicht beliebig in andere Energien umgewandelt werden. Der Film erklärt mit dem Joule die Maßeinheit für Energie. Diese DVD hat bewusst eine kurze Spielzeit, weil es sich um ein Unterrichtsfilm handelt, der gezielt für den Einsatz im Unterricht hergestellt wurde. Die DVD enthält ein nicht-gewerbliches öffentliches Vorführrecht für Schulen (Schullizenz). Die Filme können auch in der Nachhilfe eingesetzt werden.

Anbieter: Dodax
Stand: 20.01.2020
Zum Angebot

Stöbern Sie durch unser Sortiment


Alle Angebote

Eine Auswahl unserer Shops

Häufig gesucht